PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_22493
Common NameKK1_023155
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 128aa    MW: 14041.1 Da    PI: 7.2532
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_22493genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB142.78.9e-451781794
          NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                   mkk+lP n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++y+e +
  C.cajan_22493  1 MKKALPPNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYKEGD 78
                   9**************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008089.3E-23155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.6E-42181IPR009072Histone-fold
SuperFamilySSF471134.35E-32185IPR009072Histone-fold
PRINTSPR006153.2E-211937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.2E-213856No hitNo description
PRINTSPR006153.2E-215775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MKKALPPNGK IAKDAKDTMQ ECVSEFISFI TSEASEKCQK EKRKTINGDD LLWAMATLGF  60
EDYIEPLKVY LARYKEGDTK GSARSGDGSI RPDQVALAGQ NAQLVHQGSL NYIGLQVMVF  120
LSPSILNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B9e-381761792Transcription factor HapC (Eurofung)
4g92_B9e-381761792Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7755291e-115FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds.
GenBankFJ7755301e-115FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001239681.12e-79nuclear transcription factor Y subunit B-8-like
RefseqXP_006588494.12e-79PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1
SwissprotQ9SLG08e-56NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBLA0A151T1053e-92A0A151T105_CAJCA; Nuclear transcription factor Y subunit B-1
STRINGGLYMA10G33550.16e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.74e-59nuclear factor Y, subunit B1